PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10018714
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family M-type_MADS
Protein Properties Length: 252aa    MW: 28617.2 Da    PI: 6.9571
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10018714genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF892.4e-28958150
                 S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
       SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                 krien++nrqvtfskRrng++KKA+ELSvLCd++va+i+fs++g+l  +s
  Lus10018714  9 KRIENTTNRQVTFSKRRNGLIKKAYELSVLCDVDVALIMFSPSGRLSFFS 58
                 79********************************************8876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004324.1E-37160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006629.815161IPR002100Transcription factor, MADS-box
CDDcd002657.65E-35258No hitNo description
SuperFamilySSF554553.92E-27261IPR002100Transcription factor, MADS-box
PRINTSPR004043.8E-26323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003193.1E-261055IPR002100Transcription factor, MADS-box
PRINTSPR004043.8E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004043.8E-263859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MGRVKLQMKR IENTTNRQVT FSKRRNGLIK KAYELSVLCD VDVALIMFSP SGRLSFFSAR  60
DQSSGGFPNS PECQFQEFEQ GMRRLRTQME TAHKQLRILE GNVSHITTLY EAEYQEQILQ  120
DALKRLLIRK QSLEQKLVSP DADSLMIRQQ APSSIVMDWI PSPQLQVVMS PPLCVEHQNN  180
NGGNPHHDHH HWPHFDDSLV LSNHNNHNSG GLSSATDEMP RHDSCTSWEE LLLNNNMDNL  240
GFTRTNSPPS S*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-17161161Myocyte-specific enhancer factor 2B
1tqe_Q2e-17161161Myocyte-specific enhancer factor 2B
1tqe_R2e-17161161Myocyte-specific enhancer factor 2B
1tqe_S2e-17161161Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015572503.17e-52PREDICTED: agamous-like MADS-box protein AGL104 isoform X1
SwissprotQ9LM466e-33AG104_ARATH; Agamous-like MADS-box protein AGL104
TrEMBLB9R7401e-54B9R740_RICCO; Mads box protein, putative
STRINGVIT_18s0001g09540.t013e-45(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF136651922
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G22130.12e-34AGAMOUS-like 104